Anti ISY1 pAb (ATL-HPA006312)

Atlas Antibodies

Catalog No.: ATL-HPA006312-25

Protein Description: ISY1 splicing factor homolog (S. cerevisiae)
Gene Name: ISY1
Alternative Gene Name: fSAP33, KIAA1160
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000107928: 100%, ENSRNOG00000010021: 100%
Entrez Gene ID: 57461
Uniprot ID: Q9ULR0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKVKERRPFLASECTELPKAEKWRRQIIGEISKKVAQIQNAGLGEFRIRDLNDEINKLLREKGHWEVRIKELGGPDYGKVGPKMLDHEGKEVPGNRGYKYFGAAKDLPGVRELFEKEPLPPPRK
• Gene Sequence: GKVKERRPFLASECTELPKAEKWRRQIIGEISKKVAQIQNAGLGEFRIRDLNDEINKLLREKGHWEVRIKELGGPDYGKVGPKMLDHEGKEVPGNRGYKYFGAAKDLPGVRELFEKEPLPPPRK
• Gene ID - Mouse: ENSMUSG00000107928
• Gene ID - Rat: ENSRNOG00000010021
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.