Anti ISX pAb (ATL-HPA060328)

Atlas Antibodies

Catalog No.:
ATL-HPA060328-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: intestine-specific homeobox
Gene Name: ISX
Alternative Gene Name: RAXLX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031621: 53%, ENSRNOG00000039808: 57%
Entrez Gene ID: 91464
Uniprot ID: Q2M1V0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGMERNSLGCCEAPKKLSLSFSIEAILKRPARRSDMDRPEGPGEEGPGEAAASGSGLEKPPKDQPQEGRK
Gene Sequence RGMERNSLGCCEAPKKLSLSFSIEAILKRPARRSDMDRPEGPGEEGPGEAAASGSGLEKPPKDQPQEGRK
Gene ID - Mouse ENSMUSG00000031621
Gene ID - Rat ENSRNOG00000039808
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ISX pAb (ATL-HPA060328)
Datasheet Anti ISX pAb (ATL-HPA060328) Datasheet (External Link)
Vendor Page Anti ISX pAb (ATL-HPA060328) at Atlas Antibodies

Documents & Links for Anti ISX pAb (ATL-HPA060328)
Datasheet Anti ISX pAb (ATL-HPA060328) Datasheet (External Link)
Vendor Page Anti ISX pAb (ATL-HPA060328)