Anti ISOC1 pAb (ATL-HPA070307)

Atlas Antibodies

Catalog No.:
ATL-HPA070307-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: isochorismatase domain containing 1
Gene Name: ISOC1
Alternative Gene Name: CGI-111
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024601: 100%, ENSRNOG00000052099: 100%
Entrez Gene ID: 51015
Uniprot ID: Q96CN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HIVADATSSRSMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKV
Gene Sequence HIVADATSSRSMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKV
Gene ID - Mouse ENSMUSG00000024601
Gene ID - Rat ENSRNOG00000052099
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ISOC1 pAb (ATL-HPA070307)
Datasheet Anti ISOC1 pAb (ATL-HPA070307) Datasheet (External Link)
Vendor Page Anti ISOC1 pAb (ATL-HPA070307) at Atlas Antibodies

Documents & Links for Anti ISOC1 pAb (ATL-HPA070307)
Datasheet Anti ISOC1 pAb (ATL-HPA070307) Datasheet (External Link)
Vendor Page Anti ISOC1 pAb (ATL-HPA070307)