Anti ISLR2 pAb (ATL-HPA067333)

Atlas Antibodies

Catalog No.:
ATL-HPA067333-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: immunoglobulin superfamily containing leucine-rich repeat 2
Gene Name: ISLR2
Alternative Gene Name: KIAA1465
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051243: 93%, ENSRNOG00000050714: 94%
Entrez Gene ID: 57611
Uniprot ID: Q6UXK2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESEKSYPAGGEAGGEEPEDVQGEGLDEDAEQGDPSGDLQREESLAACSLVESQSKANQEEFEAGSEYSDRLPLGAEAVNIAQEINGNYR
Gene Sequence ESEKSYPAGGEAGGEEPEDVQGEGLDEDAEQGDPSGDLQREESLAACSLVESQSKANQEEFEAGSEYSDRLPLGAEAVNIAQEINGNYR
Gene ID - Mouse ENSMUSG00000051243
Gene ID - Rat ENSRNOG00000050714
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ISLR2 pAb (ATL-HPA067333)
Datasheet Anti ISLR2 pAb (ATL-HPA067333) Datasheet (External Link)
Vendor Page Anti ISLR2 pAb (ATL-HPA067333) at Atlas Antibodies

Documents & Links for Anti ISLR2 pAb (ATL-HPA067333)
Datasheet Anti ISLR2 pAb (ATL-HPA067333) Datasheet (External Link)
Vendor Page Anti ISLR2 pAb (ATL-HPA067333)