Anti ISLR2 pAb (ATL-HPA067333)

Atlas Antibodies

Catalog No.: ATL-HPA067333-25

Protein Description: immunoglobulin superfamily containing leucine-rich repeat 2
Gene Name: ISLR2
Alternative Gene Name: KIAA1465
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051243: 93%, ENSRNOG00000050714: 94%
Entrez Gene ID: 57611
Uniprot ID: Q6UXK2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESEKSYPAGGEAGGEEPEDVQGEGLDEDAEQGDPSGDLQREESLAACSLVESQSKANQEEFEAGSEYSDRLPLGAEAVNIAQEINGNYR
• Gene Sequence: ESEKSYPAGGEAGGEEPEDVQGEGLDEDAEQGDPSGDLQREESLAACSLVESQSKANQEEFEAGSEYSDRLPLGAEAVNIAQEINGNYR
• Gene ID - Mouse: ENSMUSG00000051243
• Gene ID - Rat: ENSRNOG00000050714
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.