Anti ISCU pAb (ATL-HPA057592)

Atlas Antibodies

Catalog No.:
ATL-HPA057592-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: iron-sulfur cluster assembly enzyme
Gene Name: ISCU
Alternative Gene Name: hnifU, IscU, ISU2, NIFUN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025825: 100%, ENSRNOG00000000701: 100%
Entrez Gene ID: 23479
Uniprot ID: Q9H1K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFK
Gene Sequence PARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFK
Gene ID - Mouse ENSMUSG00000025825
Gene ID - Rat ENSRNOG00000000701
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ISCU pAb (ATL-HPA057592)
Datasheet Anti ISCU pAb (ATL-HPA057592) Datasheet (External Link)
Vendor Page Anti ISCU pAb (ATL-HPA057592) at Atlas Antibodies

Documents & Links for Anti ISCU pAb (ATL-HPA057592)
Datasheet Anti ISCU pAb (ATL-HPA057592) Datasheet (External Link)
Vendor Page Anti ISCU pAb (ATL-HPA057592)