Anti ISCU pAb (ATL-HPA057592)

Atlas Antibodies

Catalog No.: ATL-HPA057592-25

Protein Description: iron-sulfur cluster assembly enzyme
Gene Name: ISCU
Alternative Gene Name: hnifU, IscU, ISU2, NIFUN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025825: 100%, ENSRNOG00000000701: 100%
Entrez Gene ID: 23479
Uniprot ID: Q9H1K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFK
• Gene Sequence: PARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFK
• Gene ID - Mouse: ENSMUSG00000025825
• Gene ID - Rat: ENSRNOG00000000701
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.