Anti ISCU pAb (ATL-HPA057592)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057592-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ISCU
Alternative Gene Name: hnifU, IscU, ISU2, NIFUN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025825: 100%, ENSRNOG00000000701: 100%
Entrez Gene ID: 23479
Uniprot ID: Q9H1K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFK |
| Gene Sequence | PARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFK |
| Gene ID - Mouse | ENSMUSG00000025825 |
| Gene ID - Rat | ENSRNOG00000000701 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ISCU pAb (ATL-HPA057592) | |
| Datasheet | Anti ISCU pAb (ATL-HPA057592) Datasheet (External Link) |
| Vendor Page | Anti ISCU pAb (ATL-HPA057592) at Atlas Antibodies |
| Documents & Links for Anti ISCU pAb (ATL-HPA057592) | |
| Datasheet | Anti ISCU pAb (ATL-HPA057592) Datasheet (External Link) |
| Vendor Page | Anti ISCU pAb (ATL-HPA057592) |