Anti ISCA2 pAb (ATL-HPA030492)

Atlas Antibodies

Catalog No.: ATL-HPA030492-25

Protein Description: iron-sulfur cluster assembly 2
Gene Name: ISCA2
Alternative Gene Name: HBLD1, ISA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021241: 89%, ENSRNOG00000012085: 89%
Entrez Gene ID: 122961
Uniprot ID: Q86U28
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGRLLTASLGPQARREASSSSPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVL
• Gene Sequence: RGRLLTASLGPQARREASSSSPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVL
• Gene ID - Mouse: ENSMUSG00000021241
• Gene ID - Rat: ENSRNOG00000012085
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ISCA2 pAb (ATL-HPA030492) – 1 Found

Green, Yangsook Song; Ferreira Dos Santos, Maria C; Fuja, Daniel G; Reichert, Ethan C; Campos, Alexandre R; Cowman, Sophie J; Acuña Pilarte, Karen; Kohan, Jessica; Tripp, Sheryl R; Leibold, Elizabeth A; Sirohi, Deepika; Agarwal, Neeraj; Liu, Xiaohui; Koh, Mei Yee. ISCA2 inhibition decreases HIF and induces ferroptosis in clear cell renal carcinoma. Oncogene. 2022;41(42):4709-4723.