Anti IRX3 pAb (ATL-HPA062522)

Atlas Antibodies

Catalog No.:
ATL-HPA062522-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: iroquois homeobox 3
Gene Name: IRX3
Alternative Gene Name: IRX-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031734: 96%, ENSRNOG00000011533: 86%
Entrez Gene ID: 79191
Uniprot ID: P78415
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FARPAEPEGGTDRCSALEVEKKLLKTAFQPVPRRPQNHLDAALVLSALSS
Gene Sequence FARPAEPEGGTDRCSALEVEKKLLKTAFQPVPRRPQNHLDAALVLSALSS
Gene ID - Mouse ENSMUSG00000031734
Gene ID - Rat ENSRNOG00000011533
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IRX3 pAb (ATL-HPA062522)
Datasheet Anti IRX3 pAb (ATL-HPA062522) Datasheet (External Link)
Vendor Page Anti IRX3 pAb (ATL-HPA062522) at Atlas Antibodies

Documents & Links for Anti IRX3 pAb (ATL-HPA062522)
Datasheet Anti IRX3 pAb (ATL-HPA062522) Datasheet (External Link)
Vendor Page Anti IRX3 pAb (ATL-HPA062522)