Anti IRX2 pAb (ATL-HPA050895)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050895-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: IRX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001504: 80%, ENSRNOG00000012742: 86%
Entrez Gene ID: 153572
Uniprot ID: Q9BZI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LHTAPKAASDAGKAGAHPLESHYRSPGGGYEPKKDASEGCTVVGGGVQPYL |
Gene Sequence | LHTAPKAASDAGKAGAHPLESHYRSPGGGYEPKKDASEGCTVVGGGVQPYL |
Gene ID - Mouse | ENSMUSG00000001504 |
Gene ID - Rat | ENSRNOG00000012742 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti IRX2 pAb (ATL-HPA050895) | |
Datasheet | Anti IRX2 pAb (ATL-HPA050895) Datasheet (External Link) |
Vendor Page | Anti IRX2 pAb (ATL-HPA050895) at Atlas Antibodies |
Documents & Links for Anti IRX2 pAb (ATL-HPA050895) | |
Datasheet | Anti IRX2 pAb (ATL-HPA050895) Datasheet (External Link) |
Vendor Page | Anti IRX2 pAb (ATL-HPA050895) |