Anti IRX2 pAb (ATL-HPA050895)

Atlas Antibodies

Catalog No.:
ATL-HPA050895-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: iroquois homeobox 2
Gene Name: IRX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001504: 80%, ENSRNOG00000012742: 86%
Entrez Gene ID: 153572
Uniprot ID: Q9BZI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LHTAPKAASDAGKAGAHPLESHYRSPGGGYEPKKDASEGCTVVGGGVQPYL
Gene Sequence LHTAPKAASDAGKAGAHPLESHYRSPGGGYEPKKDASEGCTVVGGGVQPYL
Gene ID - Mouse ENSMUSG00000001504
Gene ID - Rat ENSRNOG00000012742
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IRX2 pAb (ATL-HPA050895)
Datasheet Anti IRX2 pAb (ATL-HPA050895) Datasheet (External Link)
Vendor Page Anti IRX2 pAb (ATL-HPA050895) at Atlas Antibodies

Documents & Links for Anti IRX2 pAb (ATL-HPA050895)
Datasheet Anti IRX2 pAb (ATL-HPA050895) Datasheet (External Link)
Vendor Page Anti IRX2 pAb (ATL-HPA050895)