Anti IRS2 pAb (ATL-HPA054664)

Atlas Antibodies

Catalog No.:
ATL-HPA054664-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: insulin receptor substrate 2
Gene Name: IRS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038894: 85%, ENSRNOG00000023509: 84%
Entrez Gene ID: 8660
Uniprot ID: Q9Y4H2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELYRLPPASAVATAQGPGAASSLSSDTGDNGDYTEMAFGVAATPPQPIAAPPKPEAARVASPTSGVKRLSLMEQVSGVEAFLQAS
Gene Sequence ELYRLPPASAVATAQGPGAASSLSSDTGDNGDYTEMAFGVAATPPQPIAAPPKPEAARVASPTSGVKRLSLMEQVSGVEAFLQAS
Gene ID - Mouse ENSMUSG00000038894
Gene ID - Rat ENSRNOG00000023509
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IRS2 pAb (ATL-HPA054664)
Datasheet Anti IRS2 pAb (ATL-HPA054664) Datasheet (External Link)
Vendor Page Anti IRS2 pAb (ATL-HPA054664) at Atlas Antibodies

Documents & Links for Anti IRS2 pAb (ATL-HPA054664)
Datasheet Anti IRS2 pAb (ATL-HPA054664) Datasheet (External Link)
Vendor Page Anti IRS2 pAb (ATL-HPA054664)