Anti IRS1 pAb (ATL-HPA046433)

Atlas Antibodies

Catalog No.:
ATL-HPA046433-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: insulin receptor substrate 1
Gene Name: IRS1
Alternative Gene Name: HIRS-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055980: 93%, ENSRNOG00000014597: 92%
Entrez Gene ID: 3667
Uniprot ID: P35568
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RKRTHSAGTSPTITHQKTPSQSSVASIEEYTEMMPAYPPGGGSGGRLPGHRHSAFVPTRSYPEEGLEMHPL
Gene Sequence RKRTHSAGTSPTITHQKTPSQSSVASIEEYTEMMPAYPPGGGSGGRLPGHRHSAFVPTRSYPEEGLEMHPL
Gene ID - Mouse ENSMUSG00000055980
Gene ID - Rat ENSRNOG00000014597
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IRS1 pAb (ATL-HPA046433)
Datasheet Anti IRS1 pAb (ATL-HPA046433) Datasheet (External Link)
Vendor Page Anti IRS1 pAb (ATL-HPA046433) at Atlas Antibodies

Documents & Links for Anti IRS1 pAb (ATL-HPA046433)
Datasheet Anti IRS1 pAb (ATL-HPA046433) Datasheet (External Link)
Vendor Page Anti IRS1 pAb (ATL-HPA046433)