Anti IRGC pAb (ATL-HPA060064 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060064-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: IRGC
Alternative Gene Name: CINEMA, Iigp5, IRGC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062028: 99%, ENSRNOG00000024257: 99%
Entrez Gene ID: 56269
Uniprot ID: Q6NXR0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ALLIHSLRGYHRSFGLDDDSLAKLAEQVGKQAGDLRSVIRSPLANEVSPETVLRLYSQSSDGAMRVARAFERGIPVFGTLVA |
Gene Sequence | ALLIHSLRGYHRSFGLDDDSLAKLAEQVGKQAGDLRSVIRSPLANEVSPETVLRLYSQSSDGAMRVARAFERGIPVFGTLVA |
Gene ID - Mouse | ENSMUSG00000062028 |
Gene ID - Rat | ENSRNOG00000024257 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti IRGC pAb (ATL-HPA060064 w/enhanced validation) | |
Datasheet | Anti IRGC pAb (ATL-HPA060064 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti IRGC pAb (ATL-HPA060064 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti IRGC pAb (ATL-HPA060064 w/enhanced validation) | |
Datasheet | Anti IRGC pAb (ATL-HPA060064 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti IRGC pAb (ATL-HPA060064 w/enhanced validation) |