Anti IRGC pAb (ATL-HPA046769)

Atlas Antibodies

Catalog No.:
ATL-HPA046769-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: immunity-related GTPase family, cinema
Gene Name: IRGC
Alternative Gene Name: CINEMA, Iigp5, IRGC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062028: 93%, ENSRNOG00000024257: 93%
Entrez Gene ID: 56269
Uniprot ID: Q6NXR0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YPHPQFPDVTLWDLPGAGSPGCPADKYLKQVDFSRYDFFLLVSPRRCGAVETRLAAEILCQGKKFYFVRTKVDEDLAATRTQRPSGFREAAVLQEIRDHC
Gene Sequence YPHPQFPDVTLWDLPGAGSPGCPADKYLKQVDFSRYDFFLLVSPRRCGAVETRLAAEILCQGKKFYFVRTKVDEDLAATRTQRPSGFREAAVLQEIRDHC
Gene ID - Mouse ENSMUSG00000062028
Gene ID - Rat ENSRNOG00000024257
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IRGC pAb (ATL-HPA046769)
Datasheet Anti IRGC pAb (ATL-HPA046769) Datasheet (External Link)
Vendor Page Anti IRGC pAb (ATL-HPA046769) at Atlas Antibodies

Documents & Links for Anti IRGC pAb (ATL-HPA046769)
Datasheet Anti IRGC pAb (ATL-HPA046769) Datasheet (External Link)
Vendor Page Anti IRGC pAb (ATL-HPA046769)