Anti IRF5 pAb (ATL-HPA076024)

Atlas Antibodies

Catalog No.:
ATL-HPA076024-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: interferon regulatory factor 5
Gene Name: IRF5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029771: 98%, ENSRNOG00000007437: 98%
Entrez Gene ID: 3663
Uniprot ID: Q13568
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKE
Gene Sequence KPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKE
Gene ID - Mouse ENSMUSG00000029771
Gene ID - Rat ENSRNOG00000007437
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IRF5 pAb (ATL-HPA076024)
Datasheet Anti IRF5 pAb (ATL-HPA076024) Datasheet (External Link)
Vendor Page Anti IRF5 pAb (ATL-HPA076024) at Atlas Antibodies

Documents & Links for Anti IRF5 pAb (ATL-HPA076024)
Datasheet Anti IRF5 pAb (ATL-HPA076024) Datasheet (External Link)
Vendor Page Anti IRF5 pAb (ATL-HPA076024)