Anti IRF2BPL pAb (ATL-HPA050862 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA050862-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: interferon regulatory factor 2 binding protein-like
Gene Name: IRF2BPL
Alternative Gene Name: C14orf4, EAP1, KIAA1865
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034168: 96%, ENSRNOG00000011026: 96%
Entrez Gene ID: 64207
Uniprot ID: Q9H1B7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSSVAEVGVGAGGKRPGSVSSTDQERELKEKQRNAEALAELSESLRNRAEEWASKPKMVRDTLLTLAGCTPYEVRFKKD
Gene Sequence SSSVAEVGVGAGGKRPGSVSSTDQERELKEKQRNAEALAELSESLRNRAEEWASKPKMVRDTLLTLAGCTPYEVRFKKD
Gene ID - Mouse ENSMUSG00000034168
Gene ID - Rat ENSRNOG00000011026
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IRF2BPL pAb (ATL-HPA050862 w/enhanced validation)
Datasheet Anti IRF2BPL pAb (ATL-HPA050862 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti IRF2BPL pAb (ATL-HPA050862 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti IRF2BPL pAb (ATL-HPA050862 w/enhanced validation)
Datasheet Anti IRF2BPL pAb (ATL-HPA050862 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti IRF2BPL pAb (ATL-HPA050862 w/enhanced validation)
Citations for Anti IRF2BPL pAb (ATL-HPA050862 w/enhanced validation) – 1 Found
Yokoyama, Atsushi; Kouketsu, Takumi; Otsubo, Yuri; Noro, Erika; Sawatsubashi, Shun; Shima, Hiroki; Satoh, Ikuro; Kawamura, Sadafumi; Suzuki, Takashi; Igarashi, Kazuhiko; Sugawara, Akira. Identification and Functional Characterization of a Novel Androgen Receptor Coregulator, EAP1. Journal Of The Endocrine Society. 2021;5(11):bvab150.  PubMed