Anti IRF2BP2 pAb (ATL-HPA062269)

Atlas Antibodies

Catalog No.:
ATL-HPA062269-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: interferon regulatory factor 2 binding protein 2
Gene Name: IRF2BP2
Alternative Gene Name: IRF-2BP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051495: 96%, ENSRNOG00000049900: 94%
Entrez Gene ID: 359948
Uniprot ID: Q7Z5L9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAALILVADNAGGSHASKDANQVHSTTRRNSNSPPSPSSMNQRRLGPREV
Gene Sequence MAALILVADNAGGSHASKDANQVHSTTRRNSNSPPSPSSMNQRRLGPREV
Gene ID - Mouse ENSMUSG00000051495
Gene ID - Rat ENSRNOG00000049900
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IRF2BP2 pAb (ATL-HPA062269)
Datasheet Anti IRF2BP2 pAb (ATL-HPA062269) Datasheet (External Link)
Vendor Page Anti IRF2BP2 pAb (ATL-HPA062269) at Atlas Antibodies

Documents & Links for Anti IRF2BP2 pAb (ATL-HPA062269)
Datasheet Anti IRF2BP2 pAb (ATL-HPA062269) Datasheet (External Link)
Vendor Page Anti IRF2BP2 pAb (ATL-HPA062269)