Anti IRF2 pAb (ATL-HPA057327)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057327-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: IRF2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031627: 87%, ENSRNOG00000009824: 85%
Entrez Gene ID: 3660
Uniprot ID: P14316
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, ChIP-Exo-Seq |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SMSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSD |
Gene Sequence | SMSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSD |
Gene ID - Mouse | ENSMUSG00000031627 |
Gene ID - Rat | ENSRNOG00000009824 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti IRF2 pAb (ATL-HPA057327) | |
Datasheet | Anti IRF2 pAb (ATL-HPA057327) Datasheet (External Link) |
Vendor Page | Anti IRF2 pAb (ATL-HPA057327) at Atlas Antibodies |
Documents & Links for Anti IRF2 pAb (ATL-HPA057327) | |
Datasheet | Anti IRF2 pAb (ATL-HPA057327) Datasheet (External Link) |
Vendor Page | Anti IRF2 pAb (ATL-HPA057327) |