Anti IRF2 pAb (ATL-HPA057327)

Atlas Antibodies

Catalog No.:
ATL-HPA057327-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: interferon regulatory factor 2
Gene Name: IRF2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031627: 87%, ENSRNOG00000009824: 85%
Entrez Gene ID: 3660
Uniprot ID: P14316
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SMSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSD
Gene Sequence SMSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSD
Gene ID - Mouse ENSMUSG00000031627
Gene ID - Rat ENSRNOG00000009824
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IRF2 pAb (ATL-HPA057327)
Datasheet Anti IRF2 pAb (ATL-HPA057327) Datasheet (External Link)
Vendor Page Anti IRF2 pAb (ATL-HPA057327) at Atlas Antibodies

Documents & Links for Anti IRF2 pAb (ATL-HPA057327)
Datasheet Anti IRF2 pAb (ATL-HPA057327) Datasheet (External Link)
Vendor Page Anti IRF2 pAb (ATL-HPA057327)