Anti IRF2 pAb (ATL-HPA057327)

Atlas Antibodies

Catalog No.: ATL-HPA057327-25

Protein Description: interferon regulatory factor 2
Gene Name: IRF2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031627: 87%, ENSRNOG00000009824: 85%
Entrez Gene ID: 3660
Uniprot ID: P14316
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SMSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSD
• Gene Sequence: SMSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSD
• Gene ID - Mouse: ENSMUSG00000031627
• Gene ID - Rat: ENSRNOG00000009824
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.