Anti IRF1 pAb (ATL-HPA063131)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063131-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: IRF1
Alternative Gene Name: MAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018899: 82%, ENSRNOG00000008144: 82%
Entrez Gene ID: 3659
Uniprot ID: P10914
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC, ChIP |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTP |
| Gene Sequence | SAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTP |
| Gene ID - Mouse | ENSMUSG00000018899 |
| Gene ID - Rat | ENSRNOG00000008144 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IRF1 pAb (ATL-HPA063131) | |
| Datasheet | Anti IRF1 pAb (ATL-HPA063131) Datasheet (External Link) |
| Vendor Page | Anti IRF1 pAb (ATL-HPA063131) at Atlas Antibodies |
| Documents & Links for Anti IRF1 pAb (ATL-HPA063131) | |
| Datasheet | Anti IRF1 pAb (ATL-HPA063131) Datasheet (External Link) |
| Vendor Page | Anti IRF1 pAb (ATL-HPA063131) |
| Citations for Anti IRF1 pAb (ATL-HPA063131) – 1 Found |
| Arenas, Enrique J; Martínez-Sabadell, Alex; Rius Ruiz, Irene; Román Alonso, Macarena; Escorihuela, Marta; Luque, Antonio; Fajardo, Carlos Alberto; Gros, Alena; Klein, Christian; Arribas, Joaquín. Acquired cancer cell resistance to T cell bispecific antibodies and CAR T targeting HER2 through JAK2 down-modulation. Nature Communications. 2021;12(1):1237. PubMed |