Anti IREB2 pAb (ATL-HPA068982)

Atlas Antibodies

SKU:
ATL-HPA068982-25
  • Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: iron-responsive element binding protein 2
Gene Name: IREB2
Alternative Gene Name: IRP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032293: 90%, ENSRNOG00000013271: 90%
Entrez Gene ID: 3658
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EYGAILSFFPVDNVTLKHLEHTGFSKAKLESMETYLKAVKLFRNDQNSSGEPEYSQVIQINLNSIVPSVSGP
Gene Sequence EYGAILSFFPVDNVTLKHLEHTGFSKAKLESMETYLKAVKLFRNDQNSSGEPEYSQVIQINLNSIVPSVSGP
Gene ID - Mouse ENSMUSG00000032293
Gene ID - Rat ENSRNOG00000013271
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti IREB2 pAb (ATL-HPA068982)
Datasheet Anti IREB2 pAb (ATL-HPA068982) Datasheet (External Link)
Vendor Page Anti IREB2 pAb (ATL-HPA068982) at Atlas Antibodies

Documents & Links for Anti IREB2 pAb (ATL-HPA068982)
Datasheet Anti IREB2 pAb (ATL-HPA068982) Datasheet (External Link)
Vendor Page Anti IREB2 pAb (ATL-HPA068982)