Anti IRAK2 pAb (ATL-HPA050520)

Atlas Antibodies

Catalog No.:
ATL-HPA050520-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: interleukin-1 receptor-associated kinase 2
Gene Name: IRAK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060477: 61%, ENSRNOG00000021817: 65%
Entrez Gene ID: 3656
Uniprot ID: O43187
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKL
Gene Sequence AFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKL
Gene ID - Mouse ENSMUSG00000060477
Gene ID - Rat ENSRNOG00000021817
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IRAK2 pAb (ATL-HPA050520)
Datasheet Anti IRAK2 pAb (ATL-HPA050520) Datasheet (External Link)
Vendor Page Anti IRAK2 pAb (ATL-HPA050520) at Atlas Antibodies

Documents & Links for Anti IRAK2 pAb (ATL-HPA050520)
Datasheet Anti IRAK2 pAb (ATL-HPA050520) Datasheet (External Link)
Vendor Page Anti IRAK2 pAb (ATL-HPA050520)