Anti IQGAP1 pAb (ATL-HPA014055 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA014055-100

Protein Description: IQ motif containing GTPase activating protein 1
Gene Name: IQGAP1
Alternative Gene Name: HUMORFA01, KIAA0051, p195, SAR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030536: 97%, ENSRNOG00000012002: 97%
Entrez Gene ID: 8826
Uniprot ID: P46940
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NRALESGDVNTVWKQLSSSVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERILAIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAVLWLDEIQGG
• Gene Sequence: NRALESGDVNTVWKQLSSSVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERILAIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAVLWLDEIQGG
• Gene ID - Mouse: ENSMUSG00000030536
• Gene ID - Rat: ENSRNOG00000012002
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IQGAP1 pAb (ATL-HPA014055 w/enhanced validation) – 1 Found

Scott, Nichollas E; Rogers, Lindsay D; Prudova, Anna; Brown, Nat F; Fortelny, Nikolaus; Overall, Christopher M; Foster, Leonard J. Interactome disassembly during apoptosis occurs independent of caspase cleavage. Molecular Systems Biology. 2017;13(1):906.