Anti IQCJ pAb (ATL-HPA052835)

Atlas Antibodies

Catalog No.:
ATL-HPA052835-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: IQ motif containing J
Gene Name: IQCJ
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039656: 27%, ENSRNOG00000028627: 27%
Entrez Gene ID: 654502
Uniprot ID: Q1A5X6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STPFARAPVGKIHPYISWRLQSPGDKLPGGRKVILLYLDQLARPTGFIHTLKEPQIERLG
Gene Sequence STPFARAPVGKIHPYISWRLQSPGDKLPGGRKVILLYLDQLARPTGFIHTLKEPQIERLG
Gene ID - Mouse ENSMUSG00000039656
Gene ID - Rat ENSRNOG00000028627
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IQCJ pAb (ATL-HPA052835)
Datasheet Anti IQCJ pAb (ATL-HPA052835) Datasheet (External Link)
Vendor Page Anti IQCJ pAb (ATL-HPA052835) at Atlas Antibodies

Documents & Links for Anti IQCJ pAb (ATL-HPA052835)
Datasheet Anti IQCJ pAb (ATL-HPA052835) Datasheet (External Link)
Vendor Page Anti IQCJ pAb (ATL-HPA052835)