Anti IQCJ pAb (ATL-HPA052835)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052835-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: IQCJ
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039656: 27%, ENSRNOG00000028627: 27%
Entrez Gene ID: 654502
Uniprot ID: Q1A5X6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | STPFARAPVGKIHPYISWRLQSPGDKLPGGRKVILLYLDQLARPTGFIHTLKEPQIERLG |
Gene Sequence | STPFARAPVGKIHPYISWRLQSPGDKLPGGRKVILLYLDQLARPTGFIHTLKEPQIERLG |
Gene ID - Mouse | ENSMUSG00000039656 |
Gene ID - Rat | ENSRNOG00000028627 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti IQCJ pAb (ATL-HPA052835) | |
Datasheet | Anti IQCJ pAb (ATL-HPA052835) Datasheet (External Link) |
Vendor Page | Anti IQCJ pAb (ATL-HPA052835) at Atlas Antibodies |
Documents & Links for Anti IQCJ pAb (ATL-HPA052835) | |
Datasheet | Anti IQCJ pAb (ATL-HPA052835) Datasheet (External Link) |
Vendor Page | Anti IQCJ pAb (ATL-HPA052835) |