Anti IQCJ pAb (ATL-HPA052835)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052835-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: IQCJ
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039656: 27%, ENSRNOG00000028627: 27%
Entrez Gene ID: 654502
Uniprot ID: Q1A5X6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | STPFARAPVGKIHPYISWRLQSPGDKLPGGRKVILLYLDQLARPTGFIHTLKEPQIERLG |
| Gene Sequence | STPFARAPVGKIHPYISWRLQSPGDKLPGGRKVILLYLDQLARPTGFIHTLKEPQIERLG |
| Gene ID - Mouse | ENSMUSG00000039656 |
| Gene ID - Rat | ENSRNOG00000028627 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IQCJ pAb (ATL-HPA052835) | |
| Datasheet | Anti IQCJ pAb (ATL-HPA052835) Datasheet (External Link) |
| Vendor Page | Anti IQCJ pAb (ATL-HPA052835) at Atlas Antibodies |
| Documents & Links for Anti IQCJ pAb (ATL-HPA052835) | |
| Datasheet | Anti IQCJ pAb (ATL-HPA052835) Datasheet (External Link) |
| Vendor Page | Anti IQCJ pAb (ATL-HPA052835) |