Anti IQCD pAb (ATL-HPA046810)

Atlas Antibodies

Catalog No.:
ATL-HPA046810-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: IQ motif containing D
Gene Name: IQCD
Alternative Gene Name: CFAP84, DRC10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029601: 57%, ENSRNOG00000001378: 49%
Entrez Gene ID: 115811
Uniprot ID: Q96DY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PAINRIGPKTDPSKRPADPLKPLVLSRTKLTTIEAKRIMSILDEAIYKVELVTLLSYVASNREDMEGMLGEDVMRA
Gene Sequence PAINRIGPKTDPSKRPADPLKPLVLSRTKLTTIEAKRIMSILDEAIYKVELVTLLSYVASNREDMEGMLGEDVMRA
Gene ID - Mouse ENSMUSG00000029601
Gene ID - Rat ENSRNOG00000001378
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IQCD pAb (ATL-HPA046810)
Datasheet Anti IQCD pAb (ATL-HPA046810) Datasheet (External Link)
Vendor Page Anti IQCD pAb (ATL-HPA046810) at Atlas Antibodies

Documents & Links for Anti IQCD pAb (ATL-HPA046810)
Datasheet Anti IQCD pAb (ATL-HPA046810) Datasheet (External Link)
Vendor Page Anti IQCD pAb (ATL-HPA046810)