Anti IQCD pAb (ATL-HPA046810)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046810-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: IQCD
Alternative Gene Name: CFAP84, DRC10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029601: 57%, ENSRNOG00000001378: 49%
Entrez Gene ID: 115811
Uniprot ID: Q96DY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PAINRIGPKTDPSKRPADPLKPLVLSRTKLTTIEAKRIMSILDEAIYKVELVTLLSYVASNREDMEGMLGEDVMRA |
Gene Sequence | PAINRIGPKTDPSKRPADPLKPLVLSRTKLTTIEAKRIMSILDEAIYKVELVTLLSYVASNREDMEGMLGEDVMRA |
Gene ID - Mouse | ENSMUSG00000029601 |
Gene ID - Rat | ENSRNOG00000001378 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti IQCD pAb (ATL-HPA046810) | |
Datasheet | Anti IQCD pAb (ATL-HPA046810) Datasheet (External Link) |
Vendor Page | Anti IQCD pAb (ATL-HPA046810) at Atlas Antibodies |
Documents & Links for Anti IQCD pAb (ATL-HPA046810) | |
Datasheet | Anti IQCD pAb (ATL-HPA046810) Datasheet (External Link) |
Vendor Page | Anti IQCD pAb (ATL-HPA046810) |