Anti IPP pAb (ATL-HPA075545)

Atlas Antibodies

SKU:
ATL-HPA075545-25
  • Immunohistochemical staining of human testis shows cytoplasmic positivity in Leydig cells and cells in seminiferous ducts.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: intracisternal A particle-promoted polypeptide
Gene Name: IPP
Alternative Gene Name: KLHL27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028696: 96%, ENSRNOG00000016183: 96%
Entrez Gene ID: 3652
Uniprot ID: Q9Y573
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGLGVTVLGGMVYAIGGEKDSMIFDCTECYDPVTKQWTTVASMNHPRCGLGVCVCYGAIYALGGWVGAEIGNTIERFDPD
Gene Sequence SGLGVTVLGGMVYAIGGEKDSMIFDCTECYDPVTKQWTTVASMNHPRCGLGVCVCYGAIYALGGWVGAEIGNTIERFDPD
Gene ID - Mouse ENSMUSG00000028696
Gene ID - Rat ENSRNOG00000016183
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti IPP pAb (ATL-HPA075545)
Datasheet Anti IPP pAb (ATL-HPA075545) Datasheet (External Link)
Vendor Page Anti IPP pAb (ATL-HPA075545) at Atlas Antibodies

Documents & Links for Anti IPP pAb (ATL-HPA075545)
Datasheet Anti IPP pAb (ATL-HPA075545) Datasheet (External Link)
Vendor Page Anti IPP pAb (ATL-HPA075545)