Anti IPO5 pAb (ATL-HPA040983)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040983-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: IPO5
Alternative Gene Name: IMB3, KPNB3, MGC2068, Pse1, RANBP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030662: 100%, ENSRNOG00000010989: 100%
Entrez Gene ID: 3843
Uniprot ID: O00410
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AAEQQQFYLLLGNLLSPDNVVRKQAEETYEN |
| Gene Sequence | AAEQQQFYLLLGNLLSPDNVVRKQAEETYEN |
| Gene ID - Mouse | ENSMUSG00000030662 |
| Gene ID - Rat | ENSRNOG00000010989 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IPO5 pAb (ATL-HPA040983) | |
| Datasheet | Anti IPO5 pAb (ATL-HPA040983) Datasheet (External Link) |
| Vendor Page | Anti IPO5 pAb (ATL-HPA040983) at Atlas Antibodies |
| Documents & Links for Anti IPO5 pAb (ATL-HPA040983) | |
| Datasheet | Anti IPO5 pAb (ATL-HPA040983) Datasheet (External Link) |
| Vendor Page | Anti IPO5 pAb (ATL-HPA040983) |