Anti IPO5 pAb (ATL-HPA040983)

Atlas Antibodies

Catalog No.:
ATL-HPA040983-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: importin 5
Gene Name: IPO5
Alternative Gene Name: IMB3, KPNB3, MGC2068, Pse1, RANBP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030662: 100%, ENSRNOG00000010989: 100%
Entrez Gene ID: 3843
Uniprot ID: O00410
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AAEQQQFYLLLGNLLSPDNVVRKQAEETYEN
Gene Sequence AAEQQQFYLLLGNLLSPDNVVRKQAEETYEN
Gene ID - Mouse ENSMUSG00000030662
Gene ID - Rat ENSRNOG00000010989
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IPO5 pAb (ATL-HPA040983)
Datasheet Anti IPO5 pAb (ATL-HPA040983) Datasheet (External Link)
Vendor Page Anti IPO5 pAb (ATL-HPA040983) at Atlas Antibodies

Documents & Links for Anti IPO5 pAb (ATL-HPA040983)
Datasheet Anti IPO5 pAb (ATL-HPA040983) Datasheet (External Link)
Vendor Page Anti IPO5 pAb (ATL-HPA040983)