Anti IPO5 pAb (ATL-HPA040983)

Atlas Antibodies

Catalog No.: ATL-HPA040983-25

Protein Description: importin 5
Gene Name: IPO5
Alternative Gene Name: IMB3, KPNB3, MGC2068, Pse1, RANBP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030662: 100%, ENSRNOG00000010989: 100%
Entrez Gene ID: 3843
Uniprot ID: O00410
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AAEQQQFYLLLGNLLSPDNVVRKQAEETYEN
• Gene Sequence: AAEQQQFYLLLGNLLSPDNVVRKQAEETYEN
• Gene ID - Mouse: ENSMUSG00000030662
• Gene ID - Rat: ENSRNOG00000010989
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.