Anti IPO11 pAb (ATL-HPA067097 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA067097-25

• 
• 
• 

Protein Description: importin 11
Gene Name: IPO11
Alternative Gene Name: RanBP11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042590: 94%, ENSRNOG00000039717: 77%
Entrez Gene ID: 51194
Uniprot ID: Q9UI26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QLLGNMIEMWVDRMDNITQPERRKLSALALLSLLPSDNSVIQDKFCGIINISVEGLHDVMTEDPETGTYKDCMLMSHLEEPKVTEDEEPPTEQD
• Gene Sequence: QLLGNMIEMWVDRMDNITQPERRKLSALALLSLLPSDNSVIQDKFCGIINISVEGLHDVMTEDPETGTYKDCMLMSHLEEPKVTEDEEPPTEQD
• Gene ID - Mouse: ENSMUSG00000042590
• Gene ID - Rat: ENSRNOG00000039717
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.