Anti IPMK pAb (ATL-HPA057542)

Atlas Antibodies

Catalog No.:
ATL-HPA057542-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: inositol polyphosphate multikinase
Gene Name: IPMK
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060733: 75%, ENSRNOG00000000609: 81%
Entrez Gene ID: 253430
Uniprot ID: Q8NFU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EYNNNFHVLSSTANGKIESSVGKSLSKMYARHRKIYTKKHHSQTSLKVENLEQDNGWKSMSQEHLNGNVLSQLEKVFYHLPTGC
Gene Sequence EYNNNFHVLSSTANGKIESSVGKSLSKMYARHRKIYTKKHHSQTSLKVENLEQDNGWKSMSQEHLNGNVLSQLEKVFYHLPTGC
Gene ID - Mouse ENSMUSG00000060733
Gene ID - Rat ENSRNOG00000000609
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IPMK pAb (ATL-HPA057542)
Datasheet Anti IPMK pAb (ATL-HPA057542) Datasheet (External Link)
Vendor Page Anti IPMK pAb (ATL-HPA057542) at Atlas Antibodies

Documents & Links for Anti IPMK pAb (ATL-HPA057542)
Datasheet Anti IPMK pAb (ATL-HPA057542) Datasheet (External Link)
Vendor Page Anti IPMK pAb (ATL-HPA057542)