Anti IPCEF1 pAb (ATL-HPA028710)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028710-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: IPCEF1
Alternative Gene Name: KIAA0403, PIP3-E
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064065: 86%, ENSRNOG00000018163: 86%
Entrez Gene ID: 26034
Uniprot ID: Q8WWN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VERASECKKKHAFKISHPQIKTFYFAAENVQEMNVWLNKLGSAVIHQESTTKDEECYSESEQEDPEIAAET |
| Gene Sequence | VERASECKKKHAFKISHPQIKTFYFAAENVQEMNVWLNKLGSAVIHQESTTKDEECYSESEQEDPEIAAET |
| Gene ID - Mouse | ENSMUSG00000064065 |
| Gene ID - Rat | ENSRNOG00000018163 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IPCEF1 pAb (ATL-HPA028710) | |
| Datasheet | Anti IPCEF1 pAb (ATL-HPA028710) Datasheet (External Link) |
| Vendor Page | Anti IPCEF1 pAb (ATL-HPA028710) at Atlas Antibodies |
| Documents & Links for Anti IPCEF1 pAb (ATL-HPA028710) | |
| Datasheet | Anti IPCEF1 pAb (ATL-HPA028710) Datasheet (External Link) |
| Vendor Page | Anti IPCEF1 pAb (ATL-HPA028710) |