Anti IPCEF1 pAb (ATL-HPA028708)

Atlas Antibodies

Catalog No.: ATL-HPA028708-25

Protein Description: interaction protein for cytohesin exchange factors 1
Gene Name: IPCEF1
Alternative Gene Name: KIAA0403, PIP3-E
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064065: 81%, ENSRNOG00000018163: 78%
Entrez Gene ID: 26034
Uniprot ID: Q8WWN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LNSLSSDDTSSLSSNHDHLTVPDKPAGSKIMDKEETKVSEDDEMEKLYKSLEQASLSPLGDRR
• Gene Sequence: LNSLSSDDTSSLSSNHDHLTVPDKPAGSKIMDKEETKVSEDDEMEKLYKSLEQASLSPLGDRR
• Gene ID - Mouse: ENSMUSG00000064065
• Gene ID - Rat: ENSRNOG00000018163
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.