Anti IP6K3 pAb (ATL-HPA062531)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062531-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: IP6K3
Alternative Gene Name: IHPK3, INSP6K3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024210: 42%, ENSRNOG00000025883: 49%
Entrez Gene ID: 117283
Uniprot ID: Q96PC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LVIYDGQEPPERAPGSPHPHEAPQAAHGSSPGGLTKVDIRMID |
| Gene Sequence | LVIYDGQEPPERAPGSPHPHEAPQAAHGSSPGGLTKVDIRMID |
| Gene ID - Mouse | ENSMUSG00000024210 |
| Gene ID - Rat | ENSRNOG00000025883 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IP6K3 pAb (ATL-HPA062531) | |
| Datasheet | Anti IP6K3 pAb (ATL-HPA062531) Datasheet (External Link) |
| Vendor Page | Anti IP6K3 pAb (ATL-HPA062531) at Atlas Antibodies |
| Documents & Links for Anti IP6K3 pAb (ATL-HPA062531) | |
| Datasheet | Anti IP6K3 pAb (ATL-HPA062531) Datasheet (External Link) |
| Vendor Page | Anti IP6K3 pAb (ATL-HPA062531) |