Anti IP6K2 pAb (ATL-HPA070811)
Atlas Antibodies
- Catalog No.:
- ATL-HPA070811-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: IP6K2
Alternative Gene Name: IHPK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000106672: 94%, ENSRNOG00000020361: 96%
Entrez Gene ID: 51447
Uniprot ID: Q9UHH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEK |
Gene Sequence | RFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEK |
Gene ID - Mouse | ENSMUSG00000106672 |
Gene ID - Rat | ENSRNOG00000020361 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti IP6K2 pAb (ATL-HPA070811) | |
Datasheet | Anti IP6K2 pAb (ATL-HPA070811) Datasheet (External Link) |
Vendor Page | Anti IP6K2 pAb (ATL-HPA070811) at Atlas Antibodies |
Documents & Links for Anti IP6K2 pAb (ATL-HPA070811) | |
Datasheet | Anti IP6K2 pAb (ATL-HPA070811) Datasheet (External Link) |
Vendor Page | Anti IP6K2 pAb (ATL-HPA070811) |