Anti IP6K2 pAb (ATL-HPA070811)

Atlas Antibodies

Catalog No.:
ATL-HPA070811-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: inositol hexakisphosphate kinase 2
Gene Name: IP6K2
Alternative Gene Name: IHPK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000106672: 94%, ENSRNOG00000020361: 96%
Entrez Gene ID: 51447
Uniprot ID: Q9UHH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEK
Gene Sequence RFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEK
Gene ID - Mouse ENSMUSG00000106672
Gene ID - Rat ENSRNOG00000020361
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IP6K2 pAb (ATL-HPA070811)
Datasheet Anti IP6K2 pAb (ATL-HPA070811) Datasheet (External Link)
Vendor Page Anti IP6K2 pAb (ATL-HPA070811) at Atlas Antibodies

Documents & Links for Anti IP6K2 pAb (ATL-HPA070811)
Datasheet Anti IP6K2 pAb (ATL-HPA070811) Datasheet (External Link)
Vendor Page Anti IP6K2 pAb (ATL-HPA070811)