Anti INTS9 pAb (ATL-HPA066822)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066822-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: INTS9
Alternative Gene Name: CPSF2L, FLJ10871, RC-74
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021975: 94%, ENSRNOG00000013459: 95%
Entrez Gene ID: 55756
Uniprot ID: Q9NV88
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, ChIP |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFVQTLEKHGFSDIKVEDTAKGHIVLLQEAETLIQIEEDSTHIICDNDEMLRVRLRDLVLKFLQKF |
| Gene Sequence | QPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFVQTLEKHGFSDIKVEDTAKGHIVLLQEAETLIQIEEDSTHIICDNDEMLRVRLRDLVLKFLQKF |
| Gene ID - Mouse | ENSMUSG00000021975 |
| Gene ID - Rat | ENSRNOG00000013459 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti INTS9 pAb (ATL-HPA066822) | |
| Datasheet | Anti INTS9 pAb (ATL-HPA066822) Datasheet (External Link) |
| Vendor Page | Anti INTS9 pAb (ATL-HPA066822) at Atlas Antibodies |
| Documents & Links for Anti INTS9 pAb (ATL-HPA066822) | |
| Datasheet | Anti INTS9 pAb (ATL-HPA066822) Datasheet (External Link) |
| Vendor Page | Anti INTS9 pAb (ATL-HPA066822) |
| Citations for Anti INTS9 pAb (ATL-HPA066822) – 1 Found |
| Mascibroda, Lauren G; Shboul, Mohammad; Elrod, Nathan D; Colleaux, Laurence; Hamamy, Hanan; Huang, Kai-Lieh; Peart, Natoya; Singh, Moirangthem Kiran; Lee, Hane; Merriman, Barry; Jodoin, Jeanne N; Sitaram, Poojitha; Lee, Laura A; Fathalla, Raja; Al-Rawashdeh, Baeth; Ababneh, Osama; El-Khateeb, Mohammad; Escande-Beillard, Nathalie; Nelson, Stanley F; Wu, Yixuan; Tong, Liang; Kenney, Linda J; Roy, Sudipto; Russell, William K; Amiel, Jeanne; Reversade, Bruno; Wagner, Eric J. INTS13 variants causing a recessive developmental ciliopathy disrupt assembly of the Integrator complex. Nature Communications. 2022;13(1):6054. PubMed |