Anti INTS9 pAb (ATL-HPA066822)

Atlas Antibodies

Catalog No.: ATL-HPA066822-25

Protein Description: integrator complex subunit 9
Gene Name: INTS9
Alternative Gene Name: CPSF2L, FLJ10871, RC-74
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021975: 94%, ENSRNOG00000013459: 95%
Entrez Gene ID: 55756
Uniprot ID: Q9NV88
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFVQTLEKHGFSDIKVEDTAKGHIVLLQEAETLIQIEEDSTHIICDNDEMLRVRLRDLVLKFLQKF
• Gene Sequence: QPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFVQTLEKHGFSDIKVEDTAKGHIVLLQEAETLIQIEEDSTHIICDNDEMLRVRLRDLVLKFLQKF
• Gene ID - Mouse: ENSMUSG00000021975
• Gene ID - Rat: ENSRNOG00000013459
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti INTS9 pAb (ATL-HPA066822) – 1 Found

Mascibroda, Lauren G; Shboul, Mohammad; Elrod, Nathan D; Colleaux, Laurence; Hamamy, Hanan; Huang, Kai-Lieh; Peart, Natoya; Singh, Moirangthem Kiran; Lee, Hane; Merriman, Barry; Jodoin, Jeanne N; Sitaram, Poojitha; Lee, Laura A; Fathalla, Raja; Al-Rawashdeh, Baeth; Ababneh, Osama; El-Khateeb, Mohammad; Escande-Beillard, Nathalie; Nelson, Stanley F; Wu, Yixuan; Tong, Liang; Kenney, Linda J; Roy, Sudipto; Russell, William K; Amiel, Jeanne; Reversade, Bruno; Wagner, Eric J. INTS13 variants causing a recessive developmental ciliopathy disrupt assembly of the Integrator complex. Nature Communications. 2022;13(1):6054.