Anti INTS9 pAb (ATL-HPA051615)

Atlas Antibodies

Catalog No.:
ATL-HPA051615-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: integrator complex subunit 9
Gene Name: INTS9
Alternative Gene Name: CPSF2L, FLJ10871, RC-74
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021975: 97%, ENSRNOG00000013459: 97%
Entrez Gene ID: 55756
Uniprot ID: Q9NV88
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FAEWLCHNKQSKVYLPEPPFPHAELIQTNKLKHYPSIHGDFSNDFRQPCVVFTGHPSLRFGDVVHFMELWGKSSLNTVIFTEPDFSYLEALAP
Gene Sequence FAEWLCHNKQSKVYLPEPPFPHAELIQTNKLKHYPSIHGDFSNDFRQPCVVFTGHPSLRFGDVVHFMELWGKSSLNTVIFTEPDFSYLEALAP
Gene ID - Mouse ENSMUSG00000021975
Gene ID - Rat ENSRNOG00000013459
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti INTS9 pAb (ATL-HPA051615)
Datasheet Anti INTS9 pAb (ATL-HPA051615) Datasheet (External Link)
Vendor Page Anti INTS9 pAb (ATL-HPA051615) at Atlas Antibodies

Documents & Links for Anti INTS9 pAb (ATL-HPA051615)
Datasheet Anti INTS9 pAb (ATL-HPA051615) Datasheet (External Link)
Vendor Page Anti INTS9 pAb (ATL-HPA051615)
Citations for Anti INTS9 pAb (ATL-HPA051615) – 1 Found
Tilley, F C; Arrondel, C; Chhuon, C; Boisson, M; Cagnard, N; Parisot, M; Menara, G; Lefort, N; Guerrera, I C; Bole-Feysot, C; Benmerah, A; Antignac, C; Mollet, G. Disruption of pathways regulated by Integrator complex in Galloway-Mowat syndrome due to WDR73 mutations. Scientific Reports. 2021;11(1):5388.  PubMed