Anti INTS8 pAb (ATL-HPA057299)

Atlas Antibodies

Catalog No.:
ATL-HPA057299-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: integrator complex subunit 8
Gene Name: INTS8
Alternative Gene Name: C8orf52, FLJ20530, INT8, MGC131633
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040738: 100%, ENSRNOG00000008124: 100%
Entrez Gene ID: 55656
Uniprot ID: Q75QN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLQEQNSHDAMDSYYDYIWDVTILEYLTYLHHKRGETDKRQIAIKAIGQTELNASNPEEVLQLAAQRRKKKFLQAMAK
Gene Sequence SLQEQNSHDAMDSYYDYIWDVTILEYLTYLHHKRGETDKRQIAIKAIGQTELNASNPEEVLQLAAQRRKKKFLQAMAK
Gene ID - Mouse ENSMUSG00000040738
Gene ID - Rat ENSRNOG00000008124
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti INTS8 pAb (ATL-HPA057299)
Datasheet Anti INTS8 pAb (ATL-HPA057299) Datasheet (External Link)
Vendor Page Anti INTS8 pAb (ATL-HPA057299) at Atlas Antibodies

Documents & Links for Anti INTS8 pAb (ATL-HPA057299)
Datasheet Anti INTS8 pAb (ATL-HPA057299) Datasheet (External Link)
Vendor Page Anti INTS8 pAb (ATL-HPA057299)