Anti INTS6L pAb (ATL-HPA030747)

Atlas Antibodies

Catalog No.:
ATL-HPA030747-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: integrator complex subunit 6 like
Gene Name: INTS6L
Alternative Gene Name: DDX26B, FLJ41215
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035967: 73%, ENSRNOG00000046662: 75%
Entrez Gene ID: 203522
Uniprot ID: Q5JSJ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LMPPNQVDSLSDDFTSLSKDGLIQKPGSNAFVGGAKNCSLSVDDQKDPVASTLGAMPNTLQITPAMAQGINADIKHQLMKEVRKFGRKYER
Gene Sequence LMPPNQVDSLSDDFTSLSKDGLIQKPGSNAFVGGAKNCSLSVDDQKDPVASTLGAMPNTLQITPAMAQGINADIKHQLMKEVRKFGRKYER
Gene ID - Mouse ENSMUSG00000035967
Gene ID - Rat ENSRNOG00000046662
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti INTS6L pAb (ATL-HPA030747)
Datasheet Anti INTS6L pAb (ATL-HPA030747) Datasheet (External Link)
Vendor Page Anti INTS6L pAb (ATL-HPA030747) at Atlas Antibodies

Documents & Links for Anti INTS6L pAb (ATL-HPA030747)
Datasheet Anti INTS6L pAb (ATL-HPA030747) Datasheet (External Link)
Vendor Page Anti INTS6L pAb (ATL-HPA030747)