Anti INTS3 pAb (ATL-HPA074391)
Atlas Antibodies
- Catalog No.:
- ATL-HPA074391-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: INTS3
Alternative Gene Name: C1orf60, FLJ21919, INT3, SOSS-A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027933: 99%, ENSRNOG00000015153: 98%
Entrez Gene ID: 65123
Uniprot ID: Q68E01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LEHLDNLRLNLTNTKQNFFSQTPILQALQHVQASCDEAHKMKFSDLFSLAEEYEDSSTKPPKSRRKAALSSPRSRKNATQP |
| Gene Sequence | LEHLDNLRLNLTNTKQNFFSQTPILQALQHVQASCDEAHKMKFSDLFSLAEEYEDSSTKPPKSRRKAALSSPRSRKNATQP |
| Gene ID - Mouse | ENSMUSG00000027933 |
| Gene ID - Rat | ENSRNOG00000015153 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti INTS3 pAb (ATL-HPA074391) | |
| Datasheet | Anti INTS3 pAb (ATL-HPA074391) Datasheet (External Link) |
| Vendor Page | Anti INTS3 pAb (ATL-HPA074391) at Atlas Antibodies |
| Documents & Links for Anti INTS3 pAb (ATL-HPA074391) | |
| Datasheet | Anti INTS3 pAb (ATL-HPA074391) Datasheet (External Link) |
| Vendor Page | Anti INTS3 pAb (ATL-HPA074391) |