Anti INTS3 pAb (ATL-HPA074391)

Atlas Antibodies

Catalog No.:
ATL-HPA074391-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: integrator complex subunit 3
Gene Name: INTS3
Alternative Gene Name: C1orf60, FLJ21919, INT3, SOSS-A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027933: 99%, ENSRNOG00000015153: 98%
Entrez Gene ID: 65123
Uniprot ID: Q68E01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEHLDNLRLNLTNTKQNFFSQTPILQALQHVQASCDEAHKMKFSDLFSLAEEYEDSSTKPPKSRRKAALSSPRSRKNATQP
Gene Sequence LEHLDNLRLNLTNTKQNFFSQTPILQALQHVQASCDEAHKMKFSDLFSLAEEYEDSSTKPPKSRRKAALSSPRSRKNATQP
Gene ID - Mouse ENSMUSG00000027933
Gene ID - Rat ENSRNOG00000015153
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti INTS3 pAb (ATL-HPA074391)
Datasheet Anti INTS3 pAb (ATL-HPA074391) Datasheet (External Link)
Vendor Page Anti INTS3 pAb (ATL-HPA074391) at Atlas Antibodies

Documents & Links for Anti INTS3 pAb (ATL-HPA074391)
Datasheet Anti INTS3 pAb (ATL-HPA074391) Datasheet (External Link)
Vendor Page Anti INTS3 pAb (ATL-HPA074391)