Anti INTS13 pAb (ATL-HPA073020)

Atlas Antibodies

Catalog No.:
ATL-HPA073020-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: integrator complex subunit 13
Gene Name: INTS13
Alternative Gene Name: ASUN, C12orf11, FLJ10637, Mat89Bb, NET48, SPATA30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040250: 95%, ENSRNOG00000001808: 96%
Entrez Gene ID: 55726
Uniprot ID: Q9NVM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGKEELAEAEIIKDSPDSPEPPNKKPLVEMDETPQVEKSKGPVSLLSLWSNRINTANSRKHQEFAGRLNSVNN
Gene Sequence RGKEELAEAEIIKDSPDSPEPPNKKPLVEMDETPQVEKSKGPVSLLSLWSNRINTANSRKHQEFAGRLNSVNN
Gene ID - Mouse ENSMUSG00000040250
Gene ID - Rat ENSRNOG00000001808
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti INTS13 pAb (ATL-HPA073020)
Datasheet Anti INTS13 pAb (ATL-HPA073020) Datasheet (External Link)
Vendor Page Anti INTS13 pAb (ATL-HPA073020) at Atlas Antibodies

Documents & Links for Anti INTS13 pAb (ATL-HPA073020)
Datasheet Anti INTS13 pAb (ATL-HPA073020) Datasheet (External Link)
Vendor Page Anti INTS13 pAb (ATL-HPA073020)