Anti INTS1 pAb (ATL-HPA053009)

Atlas Antibodies

Catalog No.: ATL-HPA053009-25

Protein Description: integrator complex subunit 1
Gene Name: INTS1
Alternative Gene Name: DKFZp586J0619, INT1, KIAA1440, NET28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029547: 88%, ENSRNOG00000029773: 25%
Entrez Gene ID: 26173
Uniprot ID: Q8N201
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLDGLIHRFITLLADTSDSRALENRGADASMACRKLAVAHPLLLLRHLPMIAALLHGRTHLNFQEFRQQNHLSCF
• Gene Sequence: KLDGLIHRFITLLADTSDSRALENRGADASMACRKLAVAHPLLLLRHLPMIAALLHGRTHLNFQEFRQQNHLSCF
• Gene ID - Mouse: ENSMUSG00000029547
• Gene ID - Rat: ENSRNOG00000029773
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.