Anti INSM2 pAb (ATL-HPA051925)

Atlas Antibodies

Catalog No.:
ATL-HPA051925-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: insulinoma-associated 2
Gene Name: INSM2
Alternative Gene Name: IA-6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045440: 59%, ENSRNOG00000007754: 61%
Entrez Gene ID: 84684
Uniprot ID: Q96T92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AEGKENSRIERTADQHPQARDSSGADQHPDSAPRQGLQVLTHPEPPLPQGPYTEGVLGRRVPVPGSTSGGRGSEIFVCP
Gene Sequence AEGKENSRIERTADQHPQARDSSGADQHPDSAPRQGLQVLTHPEPPLPQGPYTEGVLGRRVPVPGSTSGGRGSEIFVCP
Gene ID - Mouse ENSMUSG00000045440
Gene ID - Rat ENSRNOG00000007754
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti INSM2 pAb (ATL-HPA051925)
Datasheet Anti INSM2 pAb (ATL-HPA051925) Datasheet (External Link)
Vendor Page Anti INSM2 pAb (ATL-HPA051925) at Atlas Antibodies

Documents & Links for Anti INSM2 pAb (ATL-HPA051925)
Datasheet Anti INSM2 pAb (ATL-HPA051925) Datasheet (External Link)
Vendor Page Anti INSM2 pAb (ATL-HPA051925)