Anti INPP5D pAb (ATL-HPA070455)
Atlas Antibodies
- Catalog No.:
- ATL-HPA070455-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: INPP5D
Alternative Gene Name: hp51CN, SHIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026288: 69%, ENSRNOG00000017020: 68%
Entrez Gene ID: 3635
Uniprot ID: Q92835
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MPRKEPPPCPEPGILSPSIVLTKAQEADRGEGPGKQVPAPRLRSFTCSSSAEGRAAGGDKSQGKPKTPVSSQAPVPAKRPIKPSRSEINQQT |
Gene Sequence | MPRKEPPPCPEPGILSPSIVLTKAQEADRGEGPGKQVPAPRLRSFTCSSSAEGRAAGGDKSQGKPKTPVSSQAPVPAKRPIKPSRSEINQQT |
Gene ID - Mouse | ENSMUSG00000026288 |
Gene ID - Rat | ENSRNOG00000017020 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti INPP5D pAb (ATL-HPA070455) | |
Datasheet | Anti INPP5D pAb (ATL-HPA070455) Datasheet (External Link) |
Vendor Page | Anti INPP5D pAb (ATL-HPA070455) at Atlas Antibodies |
Documents & Links for Anti INPP5D pAb (ATL-HPA070455) | |
Datasheet | Anti INPP5D pAb (ATL-HPA070455) Datasheet (External Link) |
Vendor Page | Anti INPP5D pAb (ATL-HPA070455) |