Anti INO80B pAb (ATL-HPA070644)
Atlas Antibodies
- Catalog No.:
- ATL-HPA070644-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: INO80B
Alternative Gene Name: hIes2, HMGA1L4, HMGIYL4, IES2, PAP-1BP, PAPA-1, ZNHIT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030034: 95%, ENSRNOG00000057972: 96%
Entrez Gene ID: 83444
Uniprot ID: Q9C086
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQRALLQKARSQPSPMLPLPVAEGCPPPALTEEMLLKREER |
| Gene Sequence | GQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQRALLQKARSQPSPMLPLPVAEGCPPPALTEEMLLKREER |
| Gene ID - Mouse | ENSMUSG00000030034 |
| Gene ID - Rat | ENSRNOG00000057972 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti INO80B pAb (ATL-HPA070644) | |
| Datasheet | Anti INO80B pAb (ATL-HPA070644) Datasheet (External Link) |
| Vendor Page | Anti INO80B pAb (ATL-HPA070644) at Atlas Antibodies |
| Documents & Links for Anti INO80B pAb (ATL-HPA070644) | |
| Datasheet | Anti INO80B pAb (ATL-HPA070644) Datasheet (External Link) |
| Vendor Page | Anti INO80B pAb (ATL-HPA070644) |