Anti INO80B pAb (ATL-HPA070644)

Atlas Antibodies

Catalog No.:
ATL-HPA070644-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: INO80 complex subunit B
Gene Name: INO80B
Alternative Gene Name: hIes2, HMGA1L4, HMGIYL4, IES2, PAP-1BP, PAPA-1, ZNHIT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030034: 95%, ENSRNOG00000057972: 96%
Entrez Gene ID: 83444
Uniprot ID: Q9C086
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQRALLQKARSQPSPMLPLPVAEGCPPPALTEEMLLKREER
Gene Sequence GQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQRALLQKARSQPSPMLPLPVAEGCPPPALTEEMLLKREER
Gene ID - Mouse ENSMUSG00000030034
Gene ID - Rat ENSRNOG00000057972
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti INO80B pAb (ATL-HPA070644)
Datasheet Anti INO80B pAb (ATL-HPA070644) Datasheet (External Link)
Vendor Page Anti INO80B pAb (ATL-HPA070644) at Atlas Antibodies

Documents & Links for Anti INO80B pAb (ATL-HPA070644)
Datasheet Anti INO80B pAb (ATL-HPA070644) Datasheet (External Link)
Vendor Page Anti INO80B pAb (ATL-HPA070644)