Anti INMT pAb (ATL-HPA061343)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061343-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: INMT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003477: 67%, ENSRNOG00000011250: 67%
Entrez Gene ID: 11185
Uniprot ID: O95050
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLL |
Gene Sequence | RVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLL |
Gene ID - Mouse | ENSMUSG00000003477 |
Gene ID - Rat | ENSRNOG00000011250 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti INMT pAb (ATL-HPA061343) | |
Datasheet | Anti INMT pAb (ATL-HPA061343) Datasheet (External Link) |
Vendor Page | Anti INMT pAb (ATL-HPA061343) at Atlas Antibodies |
Documents & Links for Anti INMT pAb (ATL-HPA061343) | |
Datasheet | Anti INMT pAb (ATL-HPA061343) Datasheet (External Link) |
Vendor Page | Anti INMT pAb (ATL-HPA061343) |