Anti INMT pAb (ATL-HPA061343)

Atlas Antibodies

Catalog No.:
ATL-HPA061343-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: indolethylamine N-methyltransferase
Gene Name: INMT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003477: 67%, ENSRNOG00000011250: 67%
Entrez Gene ID: 11185
Uniprot ID: O95050
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLL
Gene Sequence RVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLL
Gene ID - Mouse ENSMUSG00000003477
Gene ID - Rat ENSRNOG00000011250
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti INMT pAb (ATL-HPA061343)
Datasheet Anti INMT pAb (ATL-HPA061343) Datasheet (External Link)
Vendor Page Anti INMT pAb (ATL-HPA061343) at Atlas Antibodies

Documents & Links for Anti INMT pAb (ATL-HPA061343)
Datasheet Anti INMT pAb (ATL-HPA061343) Datasheet (External Link)
Vendor Page Anti INMT pAb (ATL-HPA061343)