Anti ING5 pAb (ATL-HPA042685)

Atlas Antibodies

Catalog No.: ATL-HPA042685-25

Protein Description: inhibitor of growth family, member 5
Gene Name: ING5
Alternative Gene Name: FLJ23842, p28ING5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026283: 92%, ENSRNOG00000018988: 92%
Entrez Gene ID: 84289
Uniprot ID: Q8WYH8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EDKKAEIDILAAEYISTVKTLSPDQRVERLQKIQNAYSKCKEYSDDKVQ
• Gene Sequence: EDKKAEIDILAAEYISTVKTLSPDQRVERLQKIQNAYSKCKEYSDDKVQ
• Gene ID - Mouse: ENSMUSG00000026283
• Gene ID - Rat: ENSRNOG00000018988
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.