Anti ING5 pAb (ATL-HPA042685)

Atlas Antibodies

Catalog No.:
ATL-HPA042685-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: inhibitor of growth family, member 5
Gene Name: ING5
Alternative Gene Name: FLJ23842, p28ING5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026283: 92%, ENSRNOG00000018988: 92%
Entrez Gene ID: 84289
Uniprot ID: Q8WYH8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDKKAEIDILAAEYISTVKTLSPDQRVERLQKIQNAYSKCKEYSDDKVQ
Gene Sequence EDKKAEIDILAAEYISTVKTLSPDQRVERLQKIQNAYSKCKEYSDDKVQ
Gene ID - Mouse ENSMUSG00000026283
Gene ID - Rat ENSRNOG00000018988
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ING5 pAb (ATL-HPA042685)
Datasheet Anti ING5 pAb (ATL-HPA042685) Datasheet (External Link)
Vendor Page Anti ING5 pAb (ATL-HPA042685) at Atlas Antibodies

Documents & Links for Anti ING5 pAb (ATL-HPA042685)
Datasheet Anti ING5 pAb (ATL-HPA042685) Datasheet (External Link)
Vendor Page Anti ING5 pAb (ATL-HPA042685)