Anti ING4 pAb (ATL-HPA057338)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057338-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ING4
Alternative Gene Name: my036, p29ING4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030330: 99%, ENSRNOG00000023363: 93%
Entrez Gene ID: 51147
Uniprot ID: Q9UNL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EKQIESSDYDSSSSKGKKKGRTQKEKKAARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVH |
| Gene Sequence | EKQIESSDYDSSSSKGKKKGRTQKEKKAARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVH |
| Gene ID - Mouse | ENSMUSG00000030330 |
| Gene ID - Rat | ENSRNOG00000023363 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ING4 pAb (ATL-HPA057338) | |
| Datasheet | Anti ING4 pAb (ATL-HPA057338) Datasheet (External Link) |
| Vendor Page | Anti ING4 pAb (ATL-HPA057338) at Atlas Antibodies |
| Documents & Links for Anti ING4 pAb (ATL-HPA057338) | |
| Datasheet | Anti ING4 pAb (ATL-HPA057338) Datasheet (External Link) |
| Vendor Page | Anti ING4 pAb (ATL-HPA057338) |
| Citations for Anti ING4 pAb (ATL-HPA057338) – 1 Found |
| Tang, Yu; Yang, Xinyue; Wang, Qing; Huang, Haoyu; Wang, Qinzhi; Jiang, Min; Yuan, Chunluan; Huang, Yefei; Chen, Yansu. ING4 Promotes Stemness Enrichment of Human Renal Cell Carcinoma Cells Through Inhibiting DUSP4 Expression to Activate the p38 MAPK/type I IFN-Stimulated Gene Signaling Pathway. Frontiers In Pharmacology. 13( 35496267):845097. PubMed |