Anti ING4 pAb (ATL-HPA057338)

Atlas Antibodies

Catalog No.:
ATL-HPA057338-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: inhibitor of growth family, member 4
Gene Name: ING4
Alternative Gene Name: my036, p29ING4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030330: 99%, ENSRNOG00000023363: 93%
Entrez Gene ID: 51147
Uniprot ID: Q9UNL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EKQIESSDYDSSSSKGKKKGRTQKEKKAARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVH
Gene Sequence EKQIESSDYDSSSSKGKKKGRTQKEKKAARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVH
Gene ID - Mouse ENSMUSG00000030330
Gene ID - Rat ENSRNOG00000023363
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ING4 pAb (ATL-HPA057338)
Datasheet Anti ING4 pAb (ATL-HPA057338) Datasheet (External Link)
Vendor Page Anti ING4 pAb (ATL-HPA057338) at Atlas Antibodies

Documents & Links for Anti ING4 pAb (ATL-HPA057338)
Datasheet Anti ING4 pAb (ATL-HPA057338) Datasheet (External Link)
Vendor Page Anti ING4 pAb (ATL-HPA057338)
Citations for Anti ING4 pAb (ATL-HPA057338) – 1 Found
Tang, Yu; Yang, Xinyue; Wang, Qing; Huang, Haoyu; Wang, Qinzhi; Jiang, Min; Yuan, Chunluan; Huang, Yefei; Chen, Yansu. ING4 Promotes Stemness Enrichment of Human Renal Cell Carcinoma Cells Through Inhibiting DUSP4 Expression to Activate the p38 MAPK/type I IFN-Stimulated Gene Signaling Pathway. Frontiers In Pharmacology. 13( 35496267):845097.  PubMed