Anti ING4 pAb (ATL-HPA031817)

Atlas Antibodies

Catalog No.: ATL-HPA031817-25

Protein Description: inhibitor of growth family, member 4
Gene Name: ING4
Alternative Gene Name: my036, p29ING4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030330: 99%, ENSRNOG00000023363: 93%
Entrez Gene ID: 51147
Uniprot ID: Q9UNL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKQIESSDYDSSSSKGKKKGRTQKEKKAARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVH
• Gene Sequence: EKQIESSDYDSSSSKGKKKGRTQKEKKAARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVH
• Gene ID - Mouse: ENSMUSG00000030330
• Gene ID - Rat: ENSRNOG00000023363
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.