Anti ING3 pAb (ATL-HPA067575)

Atlas Antibodies

Catalog No.: ATL-HPA067575-25

Protein Description: inhibitor of growth family, member 3
Gene Name: ING3
Alternative Gene Name: Eaf4, FLJ20089, MEAF4, p47ING3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029670: 100%, ENSRNOG00000005496: 100%
Entrez Gene ID: 54556
Uniprot ID: Q9NXR8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQI
• Gene Sequence: MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQI
• Gene ID - Mouse: ENSMUSG00000029670
• Gene ID - Rat: ENSRNOG00000005496
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ING3 pAb (ATL-HPA067575) – 1 Found

Song, Yanhua; Hou, Gaopeng; Diep, Jonathan; Ooi, Yaw Shin; Akopyants, Natalia S; Beverley, Stephen M; Carette, Jan E; Greenberg, Harry B; Ding, Siyuan. Inhibitor of growth protein 3 epigenetically silences endogenous retroviral elements and prevents innate immune activation. Nucleic Acids Research. 2021;49(22):12706-12715.