Anti ING3 pAb (ATL-HPA067575)

Atlas Antibodies

Catalog No.:
ATL-HPA067575-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: inhibitor of growth family, member 3
Gene Name: ING3
Alternative Gene Name: Eaf4, FLJ20089, MEAF4, p47ING3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029670: 100%, ENSRNOG00000005496: 100%
Entrez Gene ID: 54556
Uniprot ID: Q9NXR8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQI
Gene Sequence MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQI
Gene ID - Mouse ENSMUSG00000029670
Gene ID - Rat ENSRNOG00000005496
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ING3 pAb (ATL-HPA067575)
Datasheet Anti ING3 pAb (ATL-HPA067575) Datasheet (External Link)
Vendor Page Anti ING3 pAb (ATL-HPA067575) at Atlas Antibodies

Documents & Links for Anti ING3 pAb (ATL-HPA067575)
Datasheet Anti ING3 pAb (ATL-HPA067575) Datasheet (External Link)
Vendor Page Anti ING3 pAb (ATL-HPA067575)
Citations for Anti ING3 pAb (ATL-HPA067575) – 1 Found
Song, Yanhua; Hou, Gaopeng; Diep, Jonathan; Ooi, Yaw Shin; Akopyants, Natalia S; Beverley, Stephen M; Carette, Jan E; Greenberg, Harry B; Ding, Siyuan. Inhibitor of growth protein 3 epigenetically silences endogenous retroviral elements and prevents innate immune activation. Nucleic Acids Research. 2021;49(22):12706-12715.  PubMed