Anti ING1 pAb (ATL-HPA052591)

Atlas Antibodies

Catalog No.:
ATL-HPA052591-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: inhibitor of growth family, member 1
Gene Name: ING1
Alternative Gene Name: p24ING1c, p33, p33ING1, p33ING1b, p47, p47ING1a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045969: 78%, ENSRNOG00000014520: 77%
Entrez Gene ID: 3621
Uniprot ID: Q9UK53
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKK
Gene Sequence VELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKK
Gene ID - Mouse ENSMUSG00000045969
Gene ID - Rat ENSRNOG00000014520
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ING1 pAb (ATL-HPA052591)
Datasheet Anti ING1 pAb (ATL-HPA052591) Datasheet (External Link)
Vendor Page Anti ING1 pAb (ATL-HPA052591) at Atlas Antibodies

Documents & Links for Anti ING1 pAb (ATL-HPA052591)
Datasheet Anti ING1 pAb (ATL-HPA052591) Datasheet (External Link)
Vendor Page Anti ING1 pAb (ATL-HPA052591)