Anti ING1 pAb (ATL-HPA052591)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052591-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ING1
Alternative Gene Name: p24ING1c, p33, p33ING1, p33ING1b, p47, p47ING1a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045969: 78%, ENSRNOG00000014520: 77%
Entrez Gene ID: 3621
Uniprot ID: Q9UK53
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, ChIP-Exo-Seq |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKK |
Gene Sequence | VELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKK |
Gene ID - Mouse | ENSMUSG00000045969 |
Gene ID - Rat | ENSRNOG00000014520 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ING1 pAb (ATL-HPA052591) | |
Datasheet | Anti ING1 pAb (ATL-HPA052591) Datasheet (External Link) |
Vendor Page | Anti ING1 pAb (ATL-HPA052591) at Atlas Antibodies |
Documents & Links for Anti ING1 pAb (ATL-HPA052591) | |
Datasheet | Anti ING1 pAb (ATL-HPA052591) Datasheet (External Link) |
Vendor Page | Anti ING1 pAb (ATL-HPA052591) |