Anti ING1 pAb (ATL-HPA052591)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052591-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: ING1
Alternative Gene Name: p24ING1c, p33, p33ING1, p33ING1b, p47, p47ING1a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045969: 78%, ENSRNOG00000014520: 77%
Entrez Gene ID: 3621
Uniprot ID: Q9UK53
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKK |
| Gene Sequence | VELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKK |
| Gene ID - Mouse | ENSMUSG00000045969 |
| Gene ID - Rat | ENSRNOG00000014520 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ING1 pAb (ATL-HPA052591) | |
| Datasheet | Anti ING1 pAb (ATL-HPA052591) Datasheet (External Link) |
| Vendor Page | Anti ING1 pAb (ATL-HPA052591) at Atlas Antibodies |
| Documents & Links for Anti ING1 pAb (ATL-HPA052591) | |
| Datasheet | Anti ING1 pAb (ATL-HPA052591) Datasheet (External Link) |
| Vendor Page | Anti ING1 pAb (ATL-HPA052591) |