Anti INF2 pAb (ATL-HPA000724)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000724-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: INF2
Alternative Gene Name: C14orf151, C14orf173, MGC13251
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037679: 90%, ENSRNOG00000028650: 90%
Entrez Gene ID: 64423
Uniprot ID: Q27J81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GVARISDALLQLTCVSCVRAVMNSRQGIEYILSNQGYVRQLSQALDTSNVMVKKQVFELLAALCIYSPEGHVLTLDALDHYKTVCSQQYRFSIVMNELSGSDNVPYVVTLLSVINAVILGPEDLRARTQLRNEFIGLQLLDVLAR |
| Gene Sequence | GVARISDALLQLTCVSCVRAVMNSRQGIEYILSNQGYVRQLSQALDTSNVMVKKQVFELLAALCIYSPEGHVLTLDALDHYKTVCSQQYRFSIVMNELSGSDNVPYVVTLLSVINAVILGPEDLRARTQLRNEFIGLQLLDVLAR |
| Gene ID - Mouse | ENSMUSG00000037679 |
| Gene ID - Rat | ENSRNOG00000028650 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti INF2 pAb (ATL-HPA000724) | |
| Datasheet | Anti INF2 pAb (ATL-HPA000724) Datasheet (External Link) |
| Vendor Page | Anti INF2 pAb (ATL-HPA000724) at Atlas Antibodies |
| Documents & Links for Anti INF2 pAb (ATL-HPA000724) | |
| Datasheet | Anti INF2 pAb (ATL-HPA000724) Datasheet (External Link) |
| Vendor Page | Anti INF2 pAb (ATL-HPA000724) |
| Citations for Anti INF2 pAb (ATL-HPA000724) – 2 Found |
| Lamm, Katherine Young Bezold; Johnson, Maddison L; Baker Phillips, Julie; Muntifering, Michael B; James, Jeanne M; Jones, Helen N; Redline, Raymond W; Rokas, Antonis; Muglia, Louis J. Inverted formin 2 regulates intracellular trafficking, placentation, and pregnancy outcome. Elife. 2018;7( 29309034) PubMed |
| Sun, Hua; Al-Romaih, Khaldoun I; MacRae, Calum A; Pollak, Martin R. Human Kidney Disease-causing INF2 Mutations Perturb Rho/Dia Signaling in the Glomerulus. Ebiomedicine. 2014;1(2-3):107-15. PubMed |