Anti INCA1 pAb (ATL-HPA052401)

Atlas Antibodies

Catalog No.:
ATL-HPA052401-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: inhibitor of CDK, cyclin A1 interacting protein 1
Gene Name: INCA1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057054: 56%, ENSRNOG00000037418: 61%
Entrez Gene ID: 388324
Uniprot ID: Q0VD86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEEERATYPQEEDRFLTPGRAQLLWSPWSPLDQEEACASRQLHSLASFSTVTARRNPLHNPWGMELAASE
Gene Sequence LEEERATYPQEEDRFLTPGRAQLLWSPWSPLDQEEACASRQLHSLASFSTVTARRNPLHNPWGMELAASE
Gene ID - Mouse ENSMUSG00000057054
Gene ID - Rat ENSRNOG00000037418
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti INCA1 pAb (ATL-HPA052401)
Datasheet Anti INCA1 pAb (ATL-HPA052401) Datasheet (External Link)
Vendor Page Anti INCA1 pAb (ATL-HPA052401) at Atlas Antibodies

Documents & Links for Anti INCA1 pAb (ATL-HPA052401)
Datasheet Anti INCA1 pAb (ATL-HPA052401) Datasheet (External Link)
Vendor Page Anti INCA1 pAb (ATL-HPA052401)