Anti IMPA2 pAb (ATL-HPA029561 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA029561-25

Protein Description: inositol(myo)-1(or 4)-monophosphatase 2
Gene Name: IMPA2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024525: 92%, ENSRNOG00000018516: 91%
Entrez Gene ID: 3613
Uniprot ID: O14732
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPI
• Gene Sequence: WEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPI
• Gene ID - Mouse: ENSMUSG00000024525
• Gene ID - Rat: ENSRNOG00000018516
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IMPA2 pAb (ATL-HPA029561 w/enhanced validation) – 2 Found

Lin, Yuh-Feng; Chou, Jian-Liang; Chang, Jeng-Shou; Chiu, I-Jen; Chiu, Hui-Wen; Lin, Yuan-Feng. Dysregulation of the miR-25-IMPA2 axis promotes metastatic progression in clear cell renal cell carcinoma. Ebiomedicine. 2019;45( 31202813):220-230. 

Ablimit, Tangnur; Tursun, Gulxan; Zhang, Yuanyuan; Abduxkur, Guzalnur; Abdurexit, Gulgina; Abliz, Guzalnur. Inositol monophosphatase 2 promotes epithelial ovarian cancer cell proliferation and migration by regulating the AKT/mTOR signaling pathway. Experimental And Therapeutic Medicine. 2022;24(5):668.