Anti IMP4 pAb (ATL-HPA066222)

Atlas Antibodies

Catalog No.:
ATL-HPA066222-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: IMP4, U3 small nucleolar ribonucleoprotein
Gene Name: IMP4
Alternative Gene Name: BXDC4, MGC19606
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026127: 100%, ENSRNOG00000013285: 100%
Entrez Gene ID: 92856
Uniprot ID: Q96G21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AQRMNRGRHEVGALVRACKANGVTDLLVVHEHRGTPVGLIVSHLPFGPTAYFTLCNVVMRHDIPDLGTMSEAKPHLITHGFSSR
Gene Sequence AQRMNRGRHEVGALVRACKANGVTDLLVVHEHRGTPVGLIVSHLPFGPTAYFTLCNVVMRHDIPDLGTMSEAKPHLITHGFSSR
Gene ID - Mouse ENSMUSG00000026127
Gene ID - Rat ENSRNOG00000013285
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IMP4 pAb (ATL-HPA066222)
Datasheet Anti IMP4 pAb (ATL-HPA066222) Datasheet (External Link)
Vendor Page Anti IMP4 pAb (ATL-HPA066222) at Atlas Antibodies

Documents & Links for Anti IMP4 pAb (ATL-HPA066222)
Datasheet Anti IMP4 pAb (ATL-HPA066222) Datasheet (External Link)
Vendor Page Anti IMP4 pAb (ATL-HPA066222)